PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_5EEED86AD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 742aa    MW: 82372.6 Da    PI: 5.8653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_5EEED86AD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.83.9e-112331648
                           HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           vk++G+  W+tIa+ ++ gR +kqc++rw+++l
  Traes_1DS_5EEED86AD.2  2 VKKYGPTKWSTIAQALP-GRIGKQCRERWHNHL 33
                           9****************.*************97 PP

2Myb_DNA-binding53.94.2e-173981145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                           +++WT+eE+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  Traes_1DS_5EEED86AD.2 39 KDAWTQEEEIRLIQAHHIYGNK-WAELSKFLP-GRTDNAIKNHWH 81
                           679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.37133IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-19141IPR009057Homeodomain-like
CDDcd001675.76E-9133No hitNo description
SMARTSM007170.097135IPR001005SANT/Myb domain
PfamPF002492.9E-9233IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-281390IPR009057Homeodomain-like
PROSITE profilePS5129424.9643488IPR017930Myb domain
SMARTSM007171.0E-153886IPR001005SANT/Myb domain
PfamPF002494.0E-153981IPR001005SANT/Myb domain
CDDcd001672.10E-124181No hitNo description
Gene3DG3DSA:1.10.10.603.3E-214287IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MVKKYGPTKW STIAQALPGR IGKQCRERWH NHLNPGINKD AWTQEEEIRL IQAHHIYGNK  60
WAELSKFLPG RTDNAIKNHW HSSVKKKYES YRAEGLLAQF QGLPAVVYPT GSLNVDSSSA  120
MTQQNSDGSG LNVNQEVQDS SEFSQSALAN ISSSQVEQVD EPVGCHGQIH SSDGAHDSYS  180
SCQEACDTKA NDAASTSPET RHQLSISEND PDIHWQQDLS VADFDLQSEL WQDISYQSLL  240
TAPDSISADS FFSPNYPHSA CSSEVANNFE EPLYPLHTYS SSRTGTVHHQ SSATSVPPSF  300
ICSGRASQIV SSELPIVPES KEQQMTSVEE SLPIVPESKE QQLTSVEESQ PLESTTMGRE  360
GSPNHGKSVV GQKQHSEALC YEPPCFPSLE VPFVSCELIS SSDLPEYSPL GIRQLMRPSM  420
SFSTPLRLWS SPTCDRSRDD VLKSAAKSSV CTPSIMKKRQ REPPSPIPDV RLAKKMGTEK  480
DCGSSAMPST RTERSCRDAT RDDSLDLIPE NSKDIIYQGK TEDNANINTL EKGERCSTTE  540
RDTAYNLCQN GLMQVSAGIL TDRNGPNPER RKLNTPTKSF SKDIISSRSK PTELLVEKSS  600
VYINADYEYV NILADTPGIK RGLESPSAWK SPLFTNFQDG FFMSPTGTTF DALGLVKQIN  660
EQNAPALEEA HELLESGSLC NKESSDKENI KHIVIKKEHA TTNQISNVMI RMRFLEPTPC  720
HAKRKRRNFL LQQNANLECL HH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-3718718104C-Myb DNA-Binding Domain
1msf_C5e-3718718104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519200.0JF951920.1 Triticum aestivum clone TaMYB35 R1R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231586.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231588.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231587.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLW5ALC80.0W5ALC8_WHEAT; Uncharacterized protein
STRINGMLOC_67317.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.23e-54myb domain protein 3r-4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]